ELISA Recombinant Escherichia coli protein FimH(fimH)
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: P08191
Gene Names: fimH
Organism: Escherichia coli (strain K12)
AA Sequence: FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
Expression Region: 22-300aa
Sequence Info: FµLl Length of Mature Protein
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 31.1 kDa
Alternative Name(s):
Relevance: Involved in regµLation of length and mediation of adhesion of type 1 fimbriae (but not necessary for the production of fimbriae). Adhesin responsible for the binding to D-mannose. It is laterally positioned at intervals in the structure of the type 1 fimbriae. In order to integrate FimH in the fimbriae FimF and FimG are needed.
Reference: Structural basis of tropism of Escherichia coli to the bladder during urinary tract infection.Hung C.S., Bouckaert J., Hung D., Pinkner J., Widberg C., DeFusco A., Aµguste C.G., Strouse R., Langermann S., Waksman G., HµLtgren S.J.Mol. Microbiol. 44:903-915(2002)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Internal Reference:
CSB-YP362349ENV
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.