ELISA Recombinant Escherichia coli protein FimH(fimH)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: Yes Lead time: 3-7 working days Research Topic: Others Uniprot ID: P08191 Gene Names: fimH Organism: Escherichia coli (strain K12) AA Sequence: FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ Expression Region: 22-300aa Sequence Info: FµLl Length of Mature Protein Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 31.1 kDa Alternative Name(s): Relevance: Involved in regµLation of length and mediation of adhesion of type 1 fimbriae (but not necessary for the production of fimbriae). Adhesin responsible for the binding to D-mannose. It is laterally positioned at intervals in the structure of the type 1 fimbriae. In order to integrate FimH in the fimbriae FimF and FimG are needed. Reference: Structural basis of tropism of Escherichia coli to the bladder during urinary tract infection.Hung C.S., Bouckaert J., Hung D., Pinkner J., Widberg C., DeFusco A., Aµguste C.G., Strouse R., Langermann S., Waksman G., HµLtgren S.J.Mol. Microbiol. 44:903-915(2002) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.