ELISA Recombinant F1 capsule antigen(caf1)
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: P26948
Gene Names: caf1
Organism: Yersinia pestis
AA Sequence: ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ
Expression Region: 22-170aa
Sequence Info: FµLl Length of Mature Protein
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 17.6 kDa
Alternative Name(s):
Relevance:
Reference: "Resolving the energy paradox of chaperone/usher-mediated fibre assembly." Zavialov A.V., Tischenko V.M., Fooks L.J., Brandsdal B.O., Aqvist J., Zav'yalov V.P., Macintyre S., Knight S.D. Biochem. J. 389:685-694(2005)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.