Skip to Content

ELISA Recombinant F1 capsule antigen(caf1)

https://www.scicommhub.com/web/image/product.template/127409/image_1920?unique=812c222
>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20170725 Research areas: others Target / Protein: caf1 Biologically active: Not Tested Expression system: Yeast Species of origin: Yersinia pestis Delivery time: 3-7 business days Uniprot ID: P26948 AA Sequence: ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ Tag info: N-terminal 6xHis-tagged Expression Region: 22-170aa Protein length: FµLl Length of Mature Protein MW: 17.6 kDa Alternative Name(s): Relevance: Reference: "Resolving the energy paradox of chaperone/usher-mediated fibre assembly." Zavialov A.V., Tischenko V.M., Fooks L.J., Brandsdal B.O., Aqvist J., Zav'yalov V.P., Macintyre S., Knight S.D. Biochem. J. 389:685-694(2005) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

1,170.00 € 1170.0 EUR 1,170.00 €

1,170.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.