Skip to Content

ELISA Recombinant TRAF family member-associated NF-kappa-B activator(TANK),partial

https://www.scicommhub.com/web/image/product.template/139774/image_1920?unique=18ea82b
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Signal Transduction Uniprot ID: Q92844 Gene Names: TANK Organism: Homo sapiens () AA Sequence: MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVRRQEVSSPR Expression Region: 1-119aa Sequence Info: Partial Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 15.8 kDa Alternative Name(s): TRAF-interacting protein ;I-TRAF Relevance: Adapter protein involved in I-kappa-B-kinase (IKK) regµLation which constitutively binds TBK1 and IKBKE playing a role in antiviral innate immunity. Acts as a regµLator of TRAF function by maintaining th in a latent state. Blocks TRAF2 binding to LMP1 and inhibits LMP1-mediated NF-kappa-B activation. May control negatively TRAF2-mediated NF-kappa-B activation signaled by CD40, TNFR1 and TNFR2. Reference: I-TRAF is a novel TRAF-interacting protein that regµLates TRAF-mediated signal transduction.Rothe M., Xiong J., Shu H.-B., Williamson K., Goddard A., Goeddel D.V.Proc. Natl. Acad. Sci. U.S.A. 93:8241-8246(1996) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

791.85 € 791.85 EUR 791.85 €

791.85 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-YP023116HU

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.