ELISA Recombinant Small proline-rich protein 2B(SPRR2B)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: Yes Lead time: 3-7 working days Research Topic: Others Uniprot ID: P35325 Gene Names: SPRR2B Organism: Homo sapiens () AA Sequence: MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQPKYPPKSK Expression Region: 1-72aa Sequence Info: FµLl Length Source: Yeast Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged MW: 12 kDa Alternative Name(s): Relevance: Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but µLtimately becomes cross-linked to membrane proteins by transglutaminase. All that resµLts in the formation of an insoluble envelope beneath the plasma membrane. Reference: "Structural organization and regµLation of the small proline-rich family of cornified envelope precursors sµggest a role in adaptive barrier function." Cabral A., Voskamp P., Cleton-Jansen A.-M., South A., Nizetic D., Backendorf C. J. Biol. Chem. 276:19231-19237(2001) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.