ELISA Recombinant Small proline-rich protein 2B(SPRR2B)
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: P35325
Gene Names: SPRR2B
Organism: Homo sapiens ()
AA Sequence: MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQPKYPPKSK
Expression Region: 1-72aa
Sequence Info: FµLl Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged and C-terminal Myc-tagged
MW: 11.5 kDa
Alternative Name(s):
Relevance: Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but µLtimately becomes cross-linked to membrane proteins by transglutaminase. All that resµLts in the formation of an insoluble envelope beneath the plasma membrane.
Reference: "Genetic variation in small proline rich protein 2B as a predictor for asthma among children with eczema." Epstein T.G., LeMasters G.K., Bernstein D.I., Ericksen M.B., Martin L.J., Ryan P.H., Biagini Myers J.M., Butsch Kovacic M.S., Lindsey M.A., He H., Reponen T., Villareal M.S., Lockey J.E., Bernstein C.K., Khurana Hershey G.K. Ann. Allergy Asthma Immunol. 108:145-150(2012)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.