ELISA Recombinant Tyrosine-protein kinase transmembrane receptor ROR1(ROR1),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: Yes Lead time: 3-7 working days Research Topic: Neuroscience Uniprot ID: Q01973 Gene Names: ROR1 Organism: Homo sapiens () AA Sequence: QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPAC Expression Region: 30-391aa Sequence Info: ExtracellµLar Domain Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 42.6 kDa Alternative Name(s): Neurotrophic tyrosine kinase, receptor-related 1 Relevance: Tyrosine-protein kinase receptor whose role is not yet clear. Reference: neural tissues express a truncated Ror1 receptor tyrosine kinase, lacking both ExtracellµLar domain and transmembrane domains.Reddy U.R., Phatak S., Pleasure D.Oncogene 13:1555-1559(1996) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.