Skip to Content

ELISA Recombinant Tyrosine-protein kinase transmembrane receptor ROR1(ROR1),partial

https://www.scicommhub.com/web/image/product.template/140328/image_1920?unique=bf930ac
>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20170725 Research areas: Neuroscience Target / Protein: ROR1 Biologically active: Not Tested Expression system: Yeast Species of origin: Homo sapiens () Delivery time: 3-7 business days Uniprot ID: Q01973 AA Sequence: QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPAC Tag info: N-terminal 6xHis-tagged Expression Region: 30-391aa Protein length: ExtracellµLar Domain MW: 42.6 kDa Alternative Name(s): Neurotrophic tyrosine kinase, receptor-related 1 Relevance: Tyrosine-protein kinase receptor whose role is not yet clear. Reference: neural tissues express a truncated Ror1 receptor tyrosine kinase, lacking both ExtracellµLar domain and transmembrane domains.Reddy U.R., Phatak S., Pleasure D.Oncogene 13:1555-1559(1996) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

792.00 € 792.0 EUR 792.00 €

792.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.