Skip to Content

ELISA Recombinant T-cell surface glycoprotein CD8 alpha chain(CD8A),partial

https://www.scicommhub.com/web/image/product.template/139376/image_1920?unique=18ea82b
>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20170405 Research areas: Immunology Target / Protein: CD8A Biologically active: Not Tested Expression system: Yeast Species of origin: Homo sapiens () Delivery time: 3-7 business days Uniprot ID: P01732 AA Sequence: SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD Tag info: N-terminal 6xHis-tagged Expression Region: 22-182aa Protein length: ExtracellµLar Domain MW: 19.6 kDa Alternative Name(s): T-lymphocyte differentiation antigen T8/Leu-2 CD_antigen: CD8a Relevance: Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thoµght to play a role in the process of T-cell mediated killing. CD8 alpha chains binds to class I MHC molecµLes alpha-3 domains. Reference: "The isolation and sequence of the gene encoding T8: a molecµLe defining functional classes of T lymphocytes."Littman D.R., Thomas Y., Maddon P.J., Chess L., Axel R.Cell 40:237-246(1985) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

792.00 € 792.0 EUR 792.00 €

792.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.