ELISA Recombinant T-cell antigen CD7(CD7),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Immunology Uniprot ID: P09564 Gene Names: CD7 Organism: Homo sapiens () AA Sequence: AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP Expression Region: 26-180aa Sequence Info: ExtracellµLar Domain Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 18.4 kDa Alternative Name(s): GP40T-cell leukemia antigen;T-cell surface antigen Leu-9TP41; CD7 Relevance: Not yet known. Reference: "Identification of CD7 as a cognate of the K12 (SECTM1) protein."Lyman S.D., Escobar S., Rousseau A.-M., Armstrong A., Fanslow W.C.J. Biol. Chem. 275:3431-3437(2000) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.