ELISA Recombinant T-cell surface glycoprotein CD3 epsilon chain(CD3E),partial
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Immunology
Uniprot ID: P07766
Gene Names: CD3E
Organism: Homo sapiens ()
AA Sequence: DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD
Expression Region: 23-126aa
Sequence Info: ExtracellµLar Domain
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 13.8 kDa
Alternative Name(s): T-cell surface antigen T3/Leu-4 epsilon chain;CD_antigen: CD3e
Relevance: The CD3 complex mediates signal transduction, resµLting in T-cell activation and proliferation. Required for normal immune responses (PubMed:15546002, PubMed:8490660).
Reference: "Isolation of cDNA clones encoding the 20K non-glycosylated polypeptide chain of the T-cell receptor/T3 complex."Gold D.P., Puck J.M., Pettey C.L., Cho M., Coligan J., Woody J.N., Terhorst C.Nature 321:431-434(1986)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Internal Reference:
CSB-YP004931HU
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.