Skip to Content

ELISA Recombinant T-cell surface glycoprotein CD1c(CD1C),partial

https://www.scicommhub.com/web/image/product.template/139365/image_1920?unique=18ea82b
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Immunology Uniprot ID: P29017 Gene Names: CD1C Organism: Homo sapiens () AA Sequence: NADASQEHVSFHVIQIFSFVNQSWARGQGSGWLDELQTHGWDSESGTIIFLHNWSKGNFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGKSPEGFFQVAFNGLDLLSFQNTTWVPSPGCGSLAQSVCHLLNHQYEGVTETVYNLIRSTCPRFLLGLLDAGKMYVHRQVRPEAWLSSRPSLGSGQLLLVCHASGFYPKPVWVTWMRNEQEQLGTKHGDILPNADGTWYLQVILEVASEEPAGLSCRVRHSSLGGQDIILYWGHHFSM Expression Region: 18-302aa Sequence Info: ExtracellµLar Domain Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 34.2 kDa Alternative Name(s): Relevance: Antigen-presenting protein that binds self and non-self lipid and glycolipid antigens and presents them to T-cell receptors on natural killer T-cells. Reference: " CD1b and CD1c isoforms survey different intracellµLar compartments for the presentation of microbial lipid antigens."Briken V., Jackman R.M., Watts G.F.M., Rogers R.A., Porcelli S.A.J. Exp. Med. 192:281-288(2000) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

1,029.92 € 1029.92 EUR 1,029.92 €

1,029.92 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.