ELISA Recombinant Type-1 angiotensin II receptor(AGTR1),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Cancer Uniprot ID: P30556 Gene Names: AGTR1 Organism: Homo sapiens () AA Sequence: LNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTKKPAPCFEVE Expression Region: 297-359aa Sequence Info: Cytoplasmic Domain Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 9.2 kDa Alternative Name(s): AT1ARAT1BRAngiotensin II type-1 receptor ;AT1 Relevance: Receptor for angiotensin II. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger syst. Reference: Cloning, expression, and characterization of a gene encoding the angiotensin II type 1A receptor.Mauzy C.A., Hwang O., Egloff A.M., Wu L.H., Chung F.-Z.Biochem. Biophys. Res. Commun. 186:277-284(1992) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.