ELISA Recombinant T-cell surface glycoprotein CD3 epsilon chain(CD3E)

>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20170725 Research areas: Immunology Target / Protein: CD3E Biologically active: Not Tested Expression system: E.coli Species of origin: Homo sapiens () Delivery time: 3-7 business days Uniprot ID: P07766 AA Sequence: DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI Tag info: N-terminal GST-tagged Expression Region: 23-207aa Protein length: FµLl Length of Mature Protein MW: 47.7 kDa Alternative Name(s): T-cell surface antigen T3/Leu-4 epsilon chain; CD3e Relevance: The CD3 complex mediates signal transduction. Reference: Isolation of cDNA clones encoding the 20K non-glycosylated polypeptide chain of the T-cell receptor/T3 complex.Gold D.P., Puck J.M., Pettey C.L., Cho M., Coligan J., Woody J.N., Terhorst C.Nature 321:431-434(1986) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.