ELISA Recombinant Stanniocalcin-1(STC1),partial

>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20170725 Research areas: Signal Transduction Target / Protein: STC1 Biologically active: Not Tested Expression system: E.coli Species of origin: Homo sapiens () Delivery time: 3-7 business days Uniprot ID: P52823 AA Sequence: SAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA Tag info: N-terminal 6xHis-SUMO-tagged Expression Region: 39-247aa Protein length: Partial MW: 39.6 kDa Alternative Name(s): STC Relevance: StimµLates renal phosphate reabsorption, and coµLd therefore prevent hypercalcemia. Reference: "Signal peptide prediction based on analysis of experimentally verified cleavage sites." Zhang Z., Henzel W.J. Protein Sci. 13:2819-2824(2004) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.