ELISA Recombinant Tumor necrosis factor receptor superfamily member 19L protein(RELT),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Signal Transduction Uniprot ID: Q969Z4 Gene Names: RELT Organism: Homo sapiens () AA Sequence: STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEWGRRARRGVEVAAGASSGGETRQPGNGTRA Expression Region: 26-153aa Sequence Info: Partial Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 17.7 kDa Alternative Name(s): Receptor expressed in lymphoid tissues Relevance: Mediates activation of NF-kappa-B. May play a role in T-cell activation. Reference: RELT, a new member of the tumor necrosis factor receptor superfamily, is selectively expressed in hematopoietic tissues and activates transcription factor NF-kappaB.Sica G.L., Zhu G., Tamada K., Liu D., Ni J., Chen L.Blood 97:2702-2707(2001) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.