ELISA Recombinant Tumor necrosis factor receptor superfamily member 3(LTBR),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Epigenetics and Nuclear Signaling Uniprot ID: P36941 Gene Names: LTBR Organism: Homo sapiens () AA Sequence: QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGT Expression Region: 31-224aa Sequence Info: ExtracellµLar Domain Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 25.4 kDa Alternative Name(s): Lymphotoxin-beta receptorTumor necrosis factor C receptorTumor necrosis factor receptor 2-related protein;Tumor necrosis factor receptor type III ;TNF-RIII ;TNFR-III Relevance: Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. Promotes apoptosis via TRAF3 and TRAF5. May play a role in the development of lymphoid organs. Reference: Construction and evaluation of a hncDNA library of 12p transcribed sequences derived from a somatic cell hybrid.Baens M., Chaffanet M., Cassiman J.-J., van den Berghe H., Marynen P.Genomics 16:214-218(1993) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.