ELISA Recombinant Tricarboxylate transport protein(SLC20A3),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Transport Uniprot ID: P53007 Gene Names: SLC20A3 Organism: Homo sapiens () AA Sequence: EYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGL Expression Region: 47-87aa Sequence Info: Partial Source: E.coli Tag Info: N-terminal GST-tagged MW: 31.8 kDa Alternative Name(s): Citrate transport protein ;CTPSolute carrier family 25 member 1Tricarboxylate carrier protein Relevance: Involved in citrate-H+/malate exchange. Important for the bioenergetics of hepatic cells as it provides a carbon source for fatty acid and sterol biosyntheses, and NAD+ for the glycolytic pathway. Reference: Lysine acetylation targets protein complexes and co-regµLates major cellµLar functions.Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.Science 325:834-840(2009) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.