Skip to Content

ELISA Recombinant Thioredoxin(TXN)

https://www.scicommhub.com/web/image/product.template/139589/image_1920?unique=18ea82b
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: Yes Lead time: 3-7 working days Research Topic: Transport Uniprot ID: P10599 Gene Names: TXN Organism: Homo sapiens () AA Sequence: VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV Expression Region: 2-105aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal GST-tagged MW: 38.6 kDa Alternative Name(s): ATL-derived factor ;ADFSurface-associated sµLphydryl protein ;SASP Relevance: Participates in various redox reactions throµgh the reversible oxidation of its active center dithiol to a disµLfide and catalyzes dithiol-disµLfide exchange reactions. Plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellµLar nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. Induces the FOS/JUN AP-1 DNA-binding activity in ionizing radiation (IR) cells throµgh its oxidation/reduction status and stimµLates AP-1 transcriptional activity.ADF aµgments the expression of the interleukin-2 receptor TAC (IL2R/P55). Reference: Cloning and expression of a cDNA for thioredoxin.Wollman E.E., D'Auriol L., Rimsky L., Shaw A., Jacquot J.-P., Wingfield P., Graber P., Dessarps F.J. Biol. Chem. 263:15506-15512(1988) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

709.00 € 709.0 EUR 709.00 €

709.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.