ELISA Recombinant Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial(SDHA),partial

>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20170405 Research areas: Transport Target / Protein: SDHA Biologically active: Not Tested Expression system: E.coli Species of origin: Homo sapiens () Delivery time: 3-7 business days Uniprot ID: P31040 AA Sequence: SAKVSDSISAQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFV Tag info: N-terminal GST-tagged Expression Region: 44-293aa Protein length: Partial MW: 54.1 kDa Alternative Name(s): Flavoprotein subunit of complex II ;Fp Relevance: Flavoprotein (FP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). Can act as a tumor suppressor. Reference: Compound heterozygous mutations in the flavoprotein gene of the respiratory chain complex II in a patient with Leigh syndrome.Parfait B., Chretien D., Roetig A., Marsac C., Munnich A., Rustin P.Hum. Genet. 106:236-243(2000) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.