ELISA Recombinant Transgelin(TAGLN)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Signal Transduction Uniprot ID: Q01995 Gene Names: TAGLN Organism: Homo sapiens () AA Sequence: ANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS Expression Region: 2-201aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal GST-tagged MW: 49.5 kDa Alternative Name(s): 22KDA actin-binding protein;Protein WS3-10Smooth muscle protein 22-alpha ;SM22-alpha Relevance: Actin cross-linking/gelling protein Involved in calcium interactions and contractile properties of the cell that may contribute to replicative senescence. Reference: A novel gene encoding a smooth muscle protein is overexpressed in senescent fibroblasts.Thweatt R., Lumpkin C.K. Jr., Goldstein S.Biochem. Biophys. Res. Commun. 187:1-7(1992) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.