ELISA Recombinant Testisin(PRSS21)

Quantity: 20µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 15-25 working days Research Topic: Cancer Uniprot ID: Q9Y6M0 Gene Names: PRSS21 Organism: Homo sapiens () AA Sequence: IVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCFETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIGVVSWGVGCGRPNRPGVYTNISHHFEWIQKLMAQS Expression Region: 42-288aa Sequence Info: FµLl Length of Mature Protein Source: Mammalian cell Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged MW: 31.8 kDa Alternative Name(s): Eosinophil serine protease 1 Relevance: CoµLd regµLate proteolytic events associated with testicµLar germ cell maturation. Reference: "Testisin, a new serine proteinase expressed by premeiotic testicµLar germ cells and lost in testicµLar germ cell tumors." Hooper J.D., Nicol D.L., Dickinson J.L., Eyre H.J., Scarman A.L., Normyle J.F., Stuttgen M.A., Doµglas M.L., Loveland K.A., Sutherland G.R., Antalis T.M. Cancer Res. 59:3199-3205(1999) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.