ELISA Recombinant Tumor necrosis factor receptor superfamily member 13C(TNFRSF13C),partial (Active)

Quantity:100µg. Research Areas:Immunology Uniprot NO.:Q96RJ3 Uniprot Entry Name: Gene Names:TNFRSF13C Species:Homo sapiens () Source:Mammalian cell Expression Region:7-71aa Sequence:SLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAA Protein Description:Partial Tag Info:C-terminal hFc-Flag-tagged Mol. Weight:36.4 Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized TNFSF13B (CSB-MP897523HU1) at 2 ?g/mL can bind TNFRSF13C, the EC50 is 9.943-15.72 ng/mL. ?Measured by its binding ability in a functional ELISA. Immobilized TNFRSF13C at 2 ?g/mL can bind Biotinylated TNFSF13B (CSB-MP897523HU1-B), the EC50 is 0.2699-0.5613 ng/mL. Purity:Greater than 95% as determined by SDS-PAGE. Endotoxin:Less than 1.0 EU/µg as determined by LAL method. Form:Lyophilized powder Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4 Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Alternative Name/ Alias: Relevance: PubMed ID: Function: Involvement in disease: SubcellµLar Location: Protein Families: Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link: STRING Database Link: OMIM Database Link: