ELISA Recombinant Tumor necrosis factor ligand superfamily member 9(TNFSF9),partial (Active)

Quantity:100µg. Research Areas:Cancer Uniprot NO.:P41273 Uniprot Entry Name: Gene Names:TNFSF9 Species:Homo sapiens () Source:Mammalian cell Expression Region:71-254aa Sequence:REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE Protein Description:Partial Tag Info:N-terminal hFc-Myc-tagged Mol. Weight:48.0 kDa Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized TNFSF9 at 2 ?g/mL can bind TNFRSF9?CSB-MP023984HU1?, the EC50 is 2.671-3.702 ng/mL. Purity:Greater than 90% as determined by SDS-PAGE. Endotoxin:Less than 1.0 EU/µg as determined by LAL method. Form:Lyophilized powder Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4 Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Alternative Name/ Alias:(4-1BB ligand) (4-1BBL) Relevance:Cytokine that binds to TNFRSF9. Induces the proliferation of activated peripheral blood T-cells. May have a role in activation-induced cell death (AICD). May play a role in cognate interactions between T-cells and B-cells/macrophages. PubMed ID: Function: Involvement in disease: SubcellµLar Location: Protein Families: Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link: STRING Database Link: OMIM Database Link: