ELISA Recombinant Tumor necrosis factor ligand superfamily member 14(TNFSF14),partial (Active)

Quantity:100µg. Research Areas:Cancer Uniprot NO.:O43557 Uniprot Entry Name: Gene Names:TNFSF14 Species:Homo sapiens () Source:Mammalian cell Expression Region:74-240aa Sequence:DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV Protein Description:Partial Tag Info:N-terminal hFC-Myc-tagged Mol. Weight:46.7 kDa Biological_Activity:?Measured by its binding ability in a functional ELISA. Immobilized TNFRSF14 (CSB-MP842173HU) at 5 ?g/mL can bind TNFSF14, the EC50 is 45.44-53.29 ng/mL. Purity:Greater than 85% as determined by SDS-PAGE. Endotoxin:Less than 1.0 EU/µg as determined by LAL method. Form:Lyophilized powder Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4 Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Alternative Name/ Alias:(Herpes virus entry mediator ligand)(HVEM-L)(Herpesvirus entry mediator ligand)(CD258)(HVEmL)(LIGHT)(UNQ391)(PRO726) Relevance:Cytokine that binds to TNFRSF3/LTBR. Binding to the decoy receptor TNFRSF6B modµLates its effects. Acts as a ligand for TNFRSF14/HVEM (PubMed:9462508, PubMed:10754304). Upon binding to TNFRSF14/HVEM, delivers costimµLatory signals to T cells, leading to T cell proliferation and IFNG production (PubMed:10754304). PubMed ID: Function: Involvement in disease: SubcellµLar Location: Protein Families: Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link: STRING Database Link: OMIM Database Link: