ELISA Recombinant Tumor necrosis factor receptor superfamily member 9(TNFRSF9),partial (Active)

Quantity:100µg. Research Areas:Cancer Uniprot NO.:Q07011 Uniprot Entry Name: Gene Names:TNFRSF9 Species:Homo sapiens () Source:Mammalian cell Expression Region:24-186aa Sequence:LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ Protein Description:Partial Tag Info:C-terminal 10xHis-tagged Mol. Weight:19.1 kDa Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized TNFRSF9 at 2 ?g/mL can bind TNFSF9?CSB-MP023997HU1?, the EC50 is 1.011-2.429 ng/mL. Purity:Greater than 95% as determined by SDS-PAGE. Endotoxin:Less than 1.0 EU/µg as determined by LAL method. Form:Lyophilized powder Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4 Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Alternative Name/ Alias:(4-1BB ligand receptor) (CDw137) (T-cell antigen 4-1BB homolog) (T-cell antigen ILA) (CD antigen CD137) Relevance:Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation. PubMed ID: Function: Involvement in disease: SubcellµLar Location: Protein Families: Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link: STRING Database Link: OMIM Database Link: