ELISA Recombinant Tumor necrosis factor receptor superfamily member 1A(TNFRSF1A),partial (Active)

Quantity:100µg. Research Areas:Signal Transduction Uniprot NO.:P19438 Uniprot Entry Name: Gene Names:TNFRSF1A Species:Homo sapiens () Source:Mammalian cell Expression Region:22-211aa Sequence:IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT Protein Description:Partial Tag Info:C-terminal hFc-tagged Mol. Weight:50.1 Biological_Activity:?Measured by its binding ability in a functional ELISA. Immobilized TNF-? (CSB-YP023955HU) at 5 ?g/mL can bind TNFR1, the EC50 is 7.799-10.90 ng/mL.?Measured by its binding ability in a functional ELISA. Immobilized LTA(CSB-MP013218HU) at 5 ?g/mL can bind TNFR1, the EC50 is 4.409-6.797 ng/mL. Purity:Greater than 94% as determined by SDS-PAGE. Endotoxin:Less than 1.0 EU/µg as determined by LAL method. Form:Lyophilized powder Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4 Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Alternative Name/ Alias: Relevance: PubMed ID: Function: Involvement in disease: SubcellµLar Location: Protein Families: Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link: STRING Database Link: OMIM Database Link: