ELISA Recombinant Tumor necrosis factor receptor superfamily member 11B(TNFRSF11B) (Active)
Quantity:100µg.
Research Areas:Cancer
Uniprot NO.:O00300
Uniprot Entry Name:
Gene Names:TNFRSF11B
Species:Homo sapiens ()
Source:Mammalian cell
Expression Region:22-401aa
Sequence:ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL
Protein Description:FµLl Length of Mature Protein
Tag Info:C-terminal hFc-Flag-tagged
Mol. Weight:73.5
Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized TNFSF11 (CSB-MP023986HU1(F2)) at 10 ?g/mL can bind TNFRSF11B, the EC50 is 2.651-7.646 ng/mL.
Purity:Greater than 93.6% as determined by SDS-PAGE.
Endotoxin:Less than 1.0 EU/µg as determined by LAL method.
Form:Lyophilized powder
Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4
Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:
Relevance:
PubMed ID:
Function:
Involvement in disease:
SubcellµLar Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
Internal Reference:
CSB-MP023969HU
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.