Skip to Content

ELISA Recombinant Tumor necrosis factor receptor superfamily member 11B(TNFRSF11B) (Active)

https://www.scicommhub.com/web/image/product.template/140242/image_1920?unique=bf930ac
Quantity:100µg. Research Areas:Cancer Uniprot NO.:O00300 Uniprot Entry Name: Gene Names:TNFRSF11B Species:Homo sapiens () Source:Mammalian cell Expression Region:22-401aa Sequence:ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL Protein Description:FµLl Length of Mature Protein Tag Info:C-terminal hFc-Flag-tagged Mol. Weight:73.5 Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized TNFSF11 (CSB-MP023986HU1(F2)) at 10 ?g/mL can bind TNFRSF11B, the EC50 is 2.651-7.646 ng/mL. Purity:Greater than 93.6% as determined by SDS-PAGE. Endotoxin:Less than 1.0 EU/µg as determined by LAL method. Form:Lyophilized powder Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4 Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Alternative Name/ Alias: Relevance: PubMed ID: Function: Involvement in disease: SubcellµLar Location: Protein Families: Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link: STRING Database Link: OMIM Database Link:

543.00 € 543.0 EUR 543.00 €

543.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-MP023969HU

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.