Skip to Content

ELISA Recombinant Tumor-associated calcium signal transducer 2(TACSTD2),partial (Active)

https://www.scicommhub.com/web/image/product.template/140287/image_1920?unique=bf930ac
Quantity:100µg. Research Areas:Cancer Uniprot NO.:P09758 Uniprot Entry Name: Gene Names:TACSTD2 Species:Homo sapiens () Source:Mammalian cell Expression Region:27-274aa Sequence:HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT Protein Description:Partial Tag Info:C-terminal hFc-tagged Mol. Weight:56.8 kDa Biological_Activity:Measured in cell activity assay using U937 cells. The EC50 for this effect is 190.2-298.6 ng/mL. Purity:Greater than 90% as determined by SDS-PAGE. Endotoxin:Less than 1.0 EU/µg as determined by LAL method. Form:Lyophilized powder Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4 Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Alternative Name/ Alias:Cell surface glycoprotein Trop-2 (Membrane component chromosome 1 surface marker 1) (Pancreatic carcinoma marker protein GA733-1) (GA733-1) (M1S1) (TROP2) Relevance:Cell surface glycoprotein Trop-2 (Membrane component chromosome 1 surface marker 1) (Pancreatic carcinoma marker protein GA733-1) (GA733-1) (M1S1) (TROP2) PubMed ID: Function: Involvement in disease: SubcellµLar Location: Protein Families: Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link: STRING Database Link: OMIM Database Link:

463.00 € 463.0 EUR 463.00 €

463.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.