ELISA Recombinant T-cell antigen CD7(CD7),partial (Active)

Quantity:100µg. Research Areas:Immunology Uniprot NO.:P09564 Uniprot Entry Name: Gene Names:CD7 Species:Homo sapiens () Source:Mammalian cell Expression Region:26-180aa Sequence:AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP Protein Description:Partial Tag Info:C-terminal hFc-Myc-tagged Mol. Weight:46.54 Biological_Activity:?Measured by its binding ability in a functional ELISA. Immobilized CD7 at 5 ?g/mL can bind SECTM1 (CSB-MP819898HU), the EC50 is 1.236-1.773 ng/mL.? CD7 protein hFc and Myc tag (CSB-MP004953HU) captured on COOH chip can bind SECTM1 protein hFc tag (CSB-MP819898HU) with an affinity constant of 1.84 nM as detected by LSPR Assay. Purity:Greater than 94.5% as determined by SDS-PAGE. Endotoxin:Less than 1.0 EU/µg as determined by LAL method. Form:Lyophilized powder Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4 Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Alternative Name/ Alias: Relevance: PubMed ID: Function: Involvement in disease: SubcellµLar Location: Protein Families: Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link: STRING Database Link: OMIM Database Link: