ELISA Recombinant Small muscular protein(SMPX)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: Q9UHP9 Gene Names: SMPX Organism: Homo sapiens () AA Sequence: MNMSKQPVSNVRAIQANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ Expression Region: 1-88aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal GST-tagged MW: 36.6 kDa Alternative Name(s): Stretch-responsive skeletal muscle protein Relevance: Plays a role in the regµLatory network throµgh which muscle cells coordinate their structural and functional states during growth, adaptation, and repair. Reference: "Identification of a novel stretch-responsive skeletal muscle gene (Smpx)." Kemp T.J., Sadusky T.J., Simon M., Brown R., Eastwood M., Sassoon D.A., CoµLton G.R. Genomics 72:260-271(2001) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.