ELISA Recombinant Translation initiation factor IF-3, mitochondrial(MTIF3)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Neuroscience Uniprot ID: Q9H2K0 Gene Names: MTIF3 Organism: Homo sapiens () AA Sequence: TAPAQLSPIASAPRLSFLIHAKAFSTAEDTQNEGKKTKKNKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNTSTEPAEYQLMTGLQILQERQRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQQWIKKKHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVLRAFSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ Expression Region: 1-278aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal GST-tagged MW: 55.2 kDa Alternative Name(s): Relevance: IF-3 binds to the 28S ribosomal subunit and shifts the equilibrum between 55S ribosomes and their 39S and 28S subunits in favor of the free subunits, thus enhancing the availability of 28S subunits on which protein synthesis initiation begins. Reference: "Mitochondrial translation initiation factor 3 gene polymorphism associated with Parkinson's disease." Abahuni N., Gispert S., Bauer P., Riess O., Krµger R., Becker T., Auburger G. Neurosci. Lett. 414:126-129(2007) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.