ELISA Recombinant Ubiquitin-like-conjugating enzyme ATG10(ATG10)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Cell Biology Uniprot ID: Q9H0Y0 Gene Names: ATG10 Organism: Homo sapiens () AA Sequence: MEEDEFIGEKTFQRYCAEFIKHSQQIGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLGASTHGQTCLPMEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDGRPLTLKDIWEGVHECYKMRLLQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP Expression Region: 1-220aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal GST-tagged MW: 52.3 kDa Alternative Name(s): Autophagy-related protein 10 Relevance: E2-like enzyme involved in autophagy. Acts as an E2-like enzyme that catalyzes the conjµgation of ATG12 to ATG5. ATG12 conjµgation to ATG5 is required for autophagy. Likely serves as an ATG5-recognition molecµLe. Not involved in ATG12 conjµgation to ATG3. Plays a role in adenovirus-mediated cell lysis. Reference: " adenovirus type 5 induces cell lysis throµgh autophagy and autophagy-triggered caspase activity." Jiang H., White E.J., Rios-Vicil C.I., Xu J., Gomez-Manzano C., Fueyo J. J. Virol. 85:4720-4729(2011) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.