Skip to Content

ELISA Recombinant Thioredoxin, mitochondrial(TXN2)

https://www.scicommhub.com/web/image/product.template/139590/image_1920?unique=18ea82b
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Signal Transduction Uniprot ID: Q99757 Gene Names: TXN2 Organism: Homo sapiens () AA Sequence: TTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG Expression Region: 1-166aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal GST-tagged MW: 38.9 kDa Alternative Name(s): Thioredoxin-2 Relevance: Important for the control of mitochondrial reactive oxygen species homeostasis, apoptosis regµLation and cell viability. Possesses a dithiol-reducing activity. Reference: "Overexpressed mitochondrial thioredoxin confers resistance to oxidant-induced apoptosis in osteosarcoma cells." Chen Y., Cai J., Murphy T.J., Jones D.P. J. Biol. Chem. 277:33242-33248(2002) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

709.00 € 709.0 EUR 709.00 €

709.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.