ELISA Recombinant Tumor necrosis factor receptor superfamily member 25(TNFRSF25),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Cell Biology Uniprot ID: Q93038 Gene Names: TNFRSF25 Organism: Homo sapiens () AA Sequence: QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQ Expression Region: 25-199aa Sequence Info: ExtracellµLar Domain Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 22.9 kDa Alternative Name(s): Apo-3 Apoptosis-inducing receptor AIR Apoptosis-mediating receptor DR3 Apoptosis-mediating receptor TRAMP Death receptor 3 Lymphocyte-associated receptor of death Short name:LARD Relevance: Receptor for TNFSF12/APO3L/TWEAK. Interacts directly with the adapter TRADD. Mediates activation of NF-kappa-B and induces apoptosis. May play a role in regµLating lymphocyte homeostasis. Reference: "A death-domain-containing receptor that mediates apoptosis."Kitson J., Raven T., Jiang Y.-P., Goeddel D.V., Giles K.M., Pun K.-T., Grinham C.J., Brown R., Farrow S.N.Nature 384:372-375(1996) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.