ELISA Recombinant Selenoprotein M(SELM)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: Yes Lead time: 3-7 working days Research Topic: Others Uniprot ID: Q8WWX9 Gene Names: SELM Organism: Homo sapiens () AA Sequence: ATAYRPDWNRLSGLTRARVETCGGSQLNRLKEVKAFVTQDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAPAKPPEETSDHADL Expression Region: 24-145aa Sequence Info: FµLl Length Source: E.coli Tag Info: NO-tagged MW: 13.9 kDa Alternative Name(s): Relevance: May function as a thiol-disµLfide oxidoreductase that participates in disµLfide bond formation. Reference: "Mammalian selenoprotein in which selenocysteine (Sec) incorporation is supported by a new form of Sec insertion sequence element." Korotkov K.V., Novoselov S.V., Hatfield D.L., Gladyshev V.N. Mol. Cell. Biol. 22:1402-1411(2002) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.