ELISA Recombinant Uncharacterized protein C19orf48(C19orf48)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: Q6RUI8 Gene Names: C19orf48 Organism: Homo sapiens () AA Sequence: MTVLEAVLEIQAITGSRLLSMVPGPARPPGSCWDPTQCTRTWLLSHTPRRRWISGLPRASCRLGEEPPPLPYCDQAYGEELSIRHRETWAWLSRTDTAWPGAPGVKQARILGELLLV Expression Region: 1-117aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal GST-tagged MW: 40.1 kDa Alternative Name(s): MµLtidrµg resistance-related protein Relevance: Reference: "[Cloning and sequence analysis of a new, fµLl-length cDNA fragment of drµg resistance-related gene in lung adenocarcinoma]." Zhou X.D., Liu L.Z., Qian G.S., Huang G.J., Chen J. Ai Zheng 21:341-345(2002) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.