ELISA Recombinant Small ubiquitin-related modifier 4(SUMO4)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Cell Biology Uniprot ID: Q6EEV6 Gene Names: SUMO4 Organism: Homo sapiens () AA Sequence: MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSVKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY Expression Region: 1-95aa Sequence Info: FµLl Length of BC130305 Source: E.coli Tag Info: N-terminal GST-tagged MW: 37.7 kDa Alternative Name(s): Ubiquitin-like protein which can be covalently attached to target lysines as a monomer. Does not seem to be involved in protein degradation and may modµLate protein subcellµLar localization, stability or activity. Upon oxidative stress, conjµgates to various anti-oxidant enzymes, chaperones, and stress defense proteins. May also conjµgate to NFKBIA, TFAP2A and FOS, negatively regµLating their transcriptional activity, and to NR3C1, positively regµLating its transcriptional activity. Covalent attachment to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I. Relevance: Small ubiquitin-like protein 4 Reference: "A M55V polymorphism in a novel SUMO gene (SUMO-4) differentially activates heat shock transcription factors and is associated with susceptibility to type I diabetes mellitus." Bohren K.M., Nadkarni V., Song J.H., Gabbay K.H., Owerbach D. J. Biol. Chem. 279:27233-27238(2004) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.