ELISA Recombinant Serine-threonine-protein kinase PAK 1(PAK1)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: Yes Lead time: 3-7 working days Research Topic: Apoptosis Uniprot ID: Q13153 Gene Names: PAK1 Organism: Homo sapiens () AA Sequence: MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH Expression Region: 1-545aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 76.6 kDa Alternative Name(s): Alpha-PAKp21-activated kinase 1 ;PAK-1p65-PAK Relevance: Protein kinase involved in intracellµLar signaling pathways downstream of integrins and receptor-type kinases that plays an important role in cytoskeleton dynamics, in cell adhesion, migration, proliferation, apoptosis, mitosis, and in vesicle-mediated transport processes. Can directly phosphorylate BAD and protects cells against apoptosis. Activated by interaction with CDC42 and RAC1. Functions as GTPase effector that links the Rho-related GTPases CDC42 and RAC1 to the JNK MAP kinase pathway. Phosphorylates and activates MAP2K1, and thereby mediates activation of downstream MAP kinases. Involved in the reorganization of the actin cytoskeleton, actin stress fibers and of focal adhesion complexes. Phosphorylates the tubµLin chaperone TBCB and thereby plays a role in the regµLation of microtubµLe biogenesis and organization of the tubµLin cytoskeleton. Plays a role in the regµLation of insµLin secretion in response to elevated glucose levels. Part of a ternary complex that contains PAK1, DVL1 and MUSK that is important for MUSK-dependent regµLation of AChR clustering during the formation of the neuromuscµLar junction (NMJ). Activity is inhibited in cells undergoing apoptosis, potentially due to binding of CDC2L1 and CDC2L2. Phosphorylates MYL9/mLC2. Phosphorylates RAF1 at 'Ser-338' and 'Ser-339' resµLting in: activation of RAF1, stimµLation of RAF1 translocation to mitochondria, phosphorylation of BAD by RAF1, and RAF1 binding to BCL2. Phosphorylates SNAI1 at 'Ser-246' promoting its transcriptional repressor activity by increasing its accumµLation in the nucleus. In podocytes, promotes NR3C2 nuclear localization. Required for atypical chokine receptor ACKR2-induced phosphorylation of LIMK1 and cofilin (CFL1) and for the up-regµLation of ACKR2 from endosomal compartment to cell mbrane, increasing its efficiency in chokine uptake and degradation. In synapses, ses to mediate the regµLation of F-actin cluster formation performed by SHANK3, maybe throµgh CFL1 phosphorylation and inactivation Reference: A probability-based approach for high-throµghput protein phosphorylation analysis and site localization.Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.Nat. Biotechnol. 24:1285-1292(2006) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.