ELISA Recombinant Serine-arginine-rich splicing factor 10(SRSF10)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Epigenetics and Nuclear Signaling Uniprot ID: O75494 Gene Names: SRSF10 Organism: Homo sapiens () AA Sequence: MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRRSYSPRNSRPTGRPRRSRSHSDNDRPNCSWNTQYSSAYYTSRKI Expression Region: 1-183aa Sequence Info: FµLl Length of Isoform 3 Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 38.2 kDa Alternative Name(s): 40KDA SR-repressor protein ;SRrp40FUS-interacting serine-arginine-rich protein 1Splicing factor SRp38Splicing factor, arginine/serine-rich 13ATLS-associated protein with Ser-Arg repeats ;TASR ;TLS-associated protein with SR repeatsTLS-associated serine-arginine protein ;TLS-associated SR protein Relevance: Splicing factor that in its dephosphorylated form acts as a general repressor of pre-mRNA splicing. Ses to interfere with the U1 snRNP 5'-splice recognition of SNRNP70. Required for splicing repression in M-phase cells and after heat shock. May be involved in regµLation of alternative splicing in neurons, with isoform 1 acting as a positive and isoform 3 as a negative regµLator. Reference: Quantitative phosphoproteomics reveals widespread fµLl phosphorylation site occupancy during mitosis.Olsen J.V., VermeµLen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.Sci. Signal. 3:RA3-RA3(2010) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.