Skip to Content

ELISA Recombinant Escherichia coli Modification methylase EcoRV(ecoRVM)

https://www.scicommhub.com/web/image/product.template/126645/image_1920?unique=812c222
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P04393 Gene Names: ecoRVM Organism: Escherichia coli AA Sequence: MKDKVFVPPIKSQGIKTKLVPCIKRIVPKNFNGVWVEPFMGTGVVAFNVAPKDALLCDTNPHLISFYNALKNKDITGDLVKDFLYREGEKLLLSNGEYYYEVRERFNNYKEPLDFLFLNRSCFNGMIRFNSKGGFNVPFCKKPNRFAQAYITKISNQVDRISEIISKGNYTFLCQSFEKTIGMVNRDDVVYCDPPYIGRHVDYFNSWGERDERLLFETLSSLNATFITSTWHHNDYRENKYVRDLWSSFRILTKEHFYHVGASEKNRSPMVEALITNIAKDIIDHIEKSSGDILVIEE Expression Region: 1-298aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 50.6 kDa Alternative Name(s): Adenine-specific methyltransferase EcoRV Relevance: This methylase recognizes the double-stranded sequence GATATC, causes specific methylation on A-2 on both strands, and protects the DNA from cleavage by the EcoRV endonuclease. Reference: Characterization of the genes coding for the Eco RV restriction and modification system of Escherichia coli.Boµgueleret L., Schwarzstein M., Tsµgita A., Zabeau M.Nucleic Acids Res. 12:3659-3676(1984) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

1,066.00 € 1066.0 EUR 1,066.00 €

1,066.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.