Skip to Content

ELISA Recombinant Escherichia coli Type 1 fimbrin D-mannose specific adhesin(fimH)

https://www.scicommhub.com/web/image/product.template/127289/image_1920?unique=812c222
Quantity:100µg. Other Quantitys are also available. For further information, please contact us. Research Areas:Microbiology Uniprot ID:P08191 Gene Names:fimH Organism:Escherichia coli (strain K12) AA Sequence:FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ Expression Region:22-300aa Sequence Info:FµLl Length of Mature Protein Source:E.coli Tag Info:N-terminal 6xHis-tagged MW:33.1 Alternative Name(s):fimH; b4320; JW4283Type 1 fimbrin D-mannose specific adhesin; Protein FimH Relevance:Involved in regµLation of length and mediation of adhesion of type 1 fimbriae (but not necessary for the production of fimbriae). Adhesin responsible for the binding to D-mannose. It is laterally positioned at intervals in the structure of the type 1 fimbriae. In order to integrate FimH in the fimbriae FimF and FimG are needed. Reference:"Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110."Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006). Purity:Greater than 85% as determined by SDS-PAGE. Form:Liquid or Lyophilized powder Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Function:Involved in regµLation of length and mediation of adhesion of type 1 fimbriae (but not necessary for the production of fimbriae). Adhesin responsible for the binding to D-mannose. It is laterally positioned at intervals in the structure of the type 1 fimbriae. In order to integrate FimH in the fimbriae FimF and FimG are needed. Involvement in disease: SubcellµLar Location:Fimbrium Protein Families:Fimbrial protein family Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?ecj:JW4283 STRING Database Link:https://string-db.org/network/316407.85677063 OMIM Database Link: Lead Time Guidance:3-7 business days

1,047.70 € 1047.7 EUR 1,047.70 €

1,047.70 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days