Skip to Content

ELISA Recombinant Escherichia coli Type-1 fimbrial protein, A chain(fimA)

https://www.scicommhub.com/web/image/product.template/127291/image_1920?unique=812c222
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: Yes Lead time: 3-7 working days Research Topic: Others Uniprot ID: P04128 Gene Names: fimA Organism: Escherichia coli (strain K12) AA Sequence: AATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ Expression Region: 24-182aa Sequence Info: FµLl Length of Mature Protein Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 31.8 kDa Alternative Name(s): Type-1A pilin Relevance: Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs Reference: "Analysis of the Escherichia coli genome VI: DNA sequence of the region from 92.8 throµgh 100 minutes."Burland V.D., Plunkett G. III, Sofia H.J., Daniels D.L., Blattner F.R.Nucleic Acids Res. 23:2105-2119(1995) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

1,066.00 € 1066.0 EUR 1,066.00 €

1,066.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days