Skip to Content

ELISA Recombinant Escherichia coli Type-1 fimbrial protein, A chain(fimA)

https://www.scicommhub.com/web/image/product.template/127290/image_1920?unique=812c222
>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20170405 Research areas: Others Target / Protein: fimA Biologically active: Not Tested Expression system: E.coli Species of origin: Escherichia coli (strain K12) Delivery time: 3-7 business days Uniprot ID: P04128 AA Sequence: AATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ Tag info: N-terminal 6xHis-SUMO-tagged Expression Region: 24-182aa Protein length: FµLl Length of Mature Protein MW: 31.8 kDa Alternative Name(s): Type-1A pilin Relevance: Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs Reference: "Analysis of the Escherichia coli genome VI: DNA sequence of the region from 92.8 throµgh 100 minutes."Burland V.D., Plunkett G. III, Sofia H.J., Daniels D.L., Blattner F.R.Nucleic Acids Res. 23:2105-2119(1995) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

1,066.00 € 1066.0 EUR 1,066.00 €

1,066.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days