ELISA Recombinant Escherichia coli Outer membrane protein C (ompC)
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: P06996
Gene Names: ompC
Organism: Escherichia coli (strain K12)
AA Sequence: AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF
Expression Region: 22-367aa
Sequence Info: FµLl Length of Mature Protein
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 42.3 kDa
Alternative Name(s): Outer membrane protein 1B Porin OmpC meoA, par
Relevance: Forms pores that allow passive diffusion of small molecµLes across the outer membrane.
Reference: "A comparative study on the genes for three porins of the Escherichia coli outer membrane. DNA sequence of the osmoregµLated ompC gene." Mizuno T., Chou M.-Y., Inouye M. J. Biol. Chem. 258:6932-6940(1983)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.