Skip to Content

ELISA Recombinant Escherichia coli Outer membrane protein C (ompC)

https://www.scicommhub.com/web/image/product.template/127203/image_1920?unique=812c222
>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20171228 Research areas: Others Target / Protein: ompC Biologically active: Not Tested Expression system: E.coli Species of origin: Escherichia coli (strain K12) Delivery time: 3-7 business days Uniprot ID: P06996 AA Sequence: AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF Tag info: N-terminal 6xHis-tagged Expression Region: 22-367aa Protein length: FµLl Length of Mature Protein MW: 42.3 kDa Alternative Name(s): Outer membrane protein 1B Porin OmpC meoA, par Relevance: Forms pores that allow passive diffusion of small molecµLes across the outer membrane. Reference: "A comparative study on the genes for three porins of the Escherichia coli outer membrane. DNA sequence of the osmoregµLated ompC gene." Mizuno T., Chou M.-Y., Inouye M. J. Biol. Chem. 258:6932-6940(1983) Purity: Greater than 85% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

907.00 € 907.0 EUR 907.00 €

907.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.