Skip to Content

ELISA Recombinant Escherichia coli Heat-labile enterotoxin A chain(eltA)

https://www.scicommhub.com/web/image/product.template/126600/image_1920?unique=812c222
>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20171228 Research areas: Others Target / Protein: eltA Biologically active: Not Tested Expression system: E.coli Species of origin: Escherichia coli Delivery time: 3-7 business days Uniprot ID: P06717 AA Sequence: NGDRLYRADSRPPDEIKRSGGLMPRGHNEYFDRGTQMNINLYDHARGTQTGFVRYDDGYVSTSLSLRSAHLAGQSILSGYSTYYIYVIATAPNMFNVNDVLGVYSPHPYEQEVSALGGIPYSQIYGWYRVNFGVIDERLHRNREYRDRYYRNLNIAPAEDGYRLAGFPPDHQAWREEPWIHHAPQGCGNSSRTITGDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRIRDEL Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged Expression Region: 19-258aa Protein length: FµLl Length of Mature Protein MW: 32.8 kDa Alternative Name(s): LT-A, porcine LTP-A Relevance: The biological activity of the toxin is produced by the A chain, which activates intracellµLar adenyl cyclase. Reference: "Evolutionary origin of pathogenic determinants in enterotoxigenic Escherichia coli and Vibrio cholerae O1." Yamamoto T., Gojobori T., Yokota T. J. Bacteriol. 169:1352-1357(1987) Purity: Greater than 85% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

907.00 € 907.0 EUR 907.00 €

907.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days