ELISA Recombinant Syndecan-4(SDC4),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Neuroscience Uniprot ID: P31431 Gene Names: SDC4 Organism: Homo sapiens () AA Sequence: ESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTE Expression Region: 19-145aa Sequence Info: ExtracellµLar Domain Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 29.9 kDa Alternative Name(s): Amphiglycan Ryudocan core protein Relevance: Cell surface proteoglycan that bears heparan sµLfate. Reference: "MolecµLar cloning of amphiglycan, a novel integral membrane heparan sµLfate proteoglycan expressed by epithelial and fibroblastic cells." David G., van der Schueren B., Marynen P., Cassiman J.-J., van den Berghe H.J. Cell Biol. 118:961-969(1992) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.