Skip to Content

ELISA Recombinant Escherichia coli K99 fimbrial protein(fanC)

https://www.scicommhub.com/web/image/product.template/126617/image_1920?unique=812c222
>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20170405 Research areas: others Target / Protein: fanC Biologically active: Not Tested Expression system: E.coli Species of origin: Escherichia coli Delivery time: 3-7 business days Uniprot ID: P18103 AA Sequence: NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGSMNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSNGGYKAGVFTTSASFLVTYM Tag info: N-terminal 6xHis-SUMO-tagged Expression Region: 23-181aa Protein length: FµLl Length of Mature Protein MW: 32.5 kDa Alternative Name(s): Relevance: Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs. FanC is the main component of the K99 fimbriae. Reference: "The role of lysine-132 and arginine-136 in the receptor-binding domain of the K99 fibrillar subunit." Jacobs A.A.C., Simons L.H., de Graaf F.K. EMBO J. 6:1805-1808(1987) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

1,066.00 € 1066.0 EUR 1,066.00 €

1,066.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.