ELISA Recombinant Escherichia coli Heat-labile enterotoxin B chain(eltB)
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P0CK94
Gene Names: eltB
Organism: Escherichia coli
AA Sequence: APQSITELCSEYHNTQIYTINDKILSYTESMAGKREMVIITFKSGATFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMEN
Expression Region: 22-124aa
Sequence Info: FµLl Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 15.7 kDa
Alternative Name(s): LT-B, ;LTH-B
Relevance: The biological activity of the toxin is produced by the A chain, which activates intracellµLar adenyl cyclase.
Reference: Crystal structure of the B subunit of Escherichia coli heat-labile enterotoxin carrying peptides with anti-herpes simplex virus type 1 activity.Matkovic-Calogovic D., Loregian A., D'Acunto M.R., Battistutta R., Tossi A., Palu G., Zanotti G.J. Biol. Chem. 274:8764-8769(1999)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Internal Reference:
CSB-EP315643ENL
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.